PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016487648.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family M-type_MADS
Protein Properties Length: 195aa    MW: 22054.2 Da    PI: 9.3427
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016487648.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF72.34.1e-23959151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    k+ien++ rq t+skR+  i KKA+EL vLCd++va+++fs+tg+l  yss
  XP_016487648.1  9 KKIENSTSRQQTYSKRKDSIVKKANELAVLCDTDVALLMFSPTGQLTSYSS 59
                    68***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.0E-29160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006625.301161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.23E-25276IPR002100Transcription factor, MADS-box
PRINTSPR004044.5E-20323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.3E-211057IPR002100Transcription factor, MADS-box
PRINTSPR004044.5E-202338IPR002100Transcription factor, MADS-box
PRINTSPR004044.5E-203859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 195 aa     Download sequence    Send to blast
MGRNKLVMKK IENSTSRQQT YSKRKDSIVK KANELAVLCD TDVALLMFSP TGQLTSYSSR  60
GSVEDIMLRV VNRPGELHRR PIPNEQYFSQ RLAQLKYESE MVEKIAIAEA HEEKLNKLNQ  120
RLSEARENIR YYEPQAEGIN SVHKAVACQQ FLMSAMERIQ QLKAKLLGGE VLQRNENVEV  180
ASVNTEDTAA AGIKG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016487649.11e-143PREDICTED: agamous-like MADS-box protein AGL66
RefseqXP_016487648.11e-143PREDICTED: agamous-like MADS-box protein AGL66
RefseqXP_016487647.11e-143PREDICTED: agamous-like MADS-box protein AGL66
TrEMBLA0A0V0HT182e-80A0A0V0HT18_SOLCH; Putative MADS-box protein defh21-like
STRINGSolyc07g052700.2.11e-68(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77950.22e-30AGAMOUS-like 67